PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m013673
Common NameRCOM_1586340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 617aa    MW: 67311.3 Da    PI: 8.0998
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m013673genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.6e-24223267145
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                    d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  30170.m013673 223 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 267
                    79****************************************986 PP

2QLQ62.61e-21153189137
            QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                    ++FT++Q+++L++Q+l+yKy+ an+P+P++Ll +i+k
  30170.m013673 153 GPFTPSQWMELEHQALIYKYITANVPIPSNLLIPIRK 189
                    59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-12153189IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.6E-16154188IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.066154189IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.455223267IPR014977WRC domain
PfamPF088792.2E-20224266IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MDFGVVGFEG LVGSDTTTTT TTGSSGFASL AAAPSSDPET KQKWYGSGFL KQERSSTTTN  60
EDDWRSSKLS KTESMLLSHR STTLLKSNAT SLFTDNGQQQ MLSFSCPKPE PPSSTLPYFH  120
LTSSAAYNRN TGYMNYGNFN SANMHGVYTE ARGPFTPSQW MELEHQALIY KYITANVPIP  180
SNLLIPIRKA LDSAGFSSFS GGLLRPNTLP WGAFHLGFSS NNDPEPGRCR RTDGKKWRCS  240
RDAVADQKYC ERHMNRGRHR SRKHVEGQSG HSAAAATKTT NAKPMSTPSS SSASASVVGL  300
HGSGASNNLI IAQNQQQLKN LQPDSSSNLS ADTLVNRMIL NKENLGERLQ DSPSLSMQSS  360
KIYLKSKENP FFISKHPYQE SSQIEFGHVN FDSLLNPSQN SSSLISCRNF ASSQDMSGQE  420
TISQHSFRQF MDDWPKSQSD QSSVSWPQLD VQSDRTQLSI SIPNDPTDFK SSTSSPSNEI  480
FAVSPLRLSR DLDSIQTGTG VDIVFNDHKQ KQANWRPVPW ETSVGGPLGE VLHNSNNSAS  540
ECKNSSGLNL LVERWDSSSQ LGLSPTGVLQ KTTFGSLSNS SAGSSPRTEN NRTREGASLC  600
SDLLGPSLMH SSSFPAL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576401.10.0PREDICTED: growth-regulating factor 1
TrEMBLB9R6V90.0B9R6V9_RICCO; Putative uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-89growth-regulating factor 1